Road van No.8jinshun het Nieuwe District van Zhuqiao Pudong, Shanghai, China
Thuis ProductenInjecteerbare Peptides

Spier de Bouwpeptides cjc-1295 zonder DAC voor Bodybuilders

Spier de Bouwpeptides cjc-1295 zonder DAC voor Bodybuilders

    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
  • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders


    Plaats van herkomst: Shanghai
    Merknaam: FILTER
    Certificering: GMP
    Modelnummer: API

    Betalen & Verzenden Algemene voorwaarden:

    Min. bestelaantal: 10 flesjes
    Prijs: USD 4~8 per vial
    Verpakking Details: 2mg, 5mg/vial, 10mg/vial of zonodig
    Levertijd: Binnen 3 werkdagen
    Betalingscondities: L/C, T/T, Western Union, MoneyGram, Payneer
    Levering vermogen: 100,000VIALS/MONTH
    Contact nu
    Gedetailleerde productomschrijving
    Specificatie: 2mg/vial Verschijning: wit poeder
    DeliveryTime: binnen 3~7 werkdagen Poort: Shanghai/Shenzhen/Hongkong
    Pakket: Icebag, Discrete Verpakkingsmanieren voor uw verwijzing LimitNum: 10 flesjes
    Zuiverheid: 99% Vervoer: DHL, Fedix, HKEMS, HKEUB, TNT
    opslagruimte: droge, donkere en geventileerde plaats, (dogree 2~8)
    Hoog licht:

    peptides bodybuilding supplements


    human growth peptides

    Cjc-1295 met DAC

    Productnaam: CJC1295 DAC; CJC1295 met DAC
    Alias: CJC1295 (GHRH/DAC)
    Opeenvolging: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-LysLys (Maleimidopropionyl) - NH2 (Complexe Affiniteit)
    Dichtheid: 1.45
    Cjc-1295 met DAC
    Type: Immune Functie AgentsGrade
    Norm: Geneeskunderang
    Classificatie: Brassinosteroid
    MF: C165H271N47O46
    Molecuulgewicht: 3649.30
    Zuiverheid (HPLC): 98.0%
    Verschijning: Wit poeder
    Enige Onzuiverheid (HPLC): 1.0%
    Aminozuursamenstelling: 10% van theoretisch
    Peptide Inhoud (N%): 80% (door %N)
    Watergehalte (Karl Fischer): 6.0%
    Acetaatinhoud (HPIC): 15.0%
    Massasaldo: 95.0~105.0%

    Co. van filterbiotech, Ltd Bedrijfsgebied:

    Als Peptides en Steroïdenfabrikant, zijn wij voor OEM voor cliënten die Merkenvereisten hebben. (De Naar maat gemaakte Dienst).
    Onze Bedrijfdiensten:

    1. Farmaceutische Peptide+Bodubuilding-Peptide
    2. Kosmetische Peptide
    3. Sterodispoeder, Olie en Lusjes
    4. De naar maat gemaakte Dienst

    Welke men typt uw cliënten verkiest?


    Productnaam: CJC1295
    Synoniemen: CJC1295; Y (D - A) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6- [3 (2,5-dihydro-2,5-dioxo-1H-pyrrol-1) - 1-oxopropyl] - l-Lysinamide; Cjc-1295 Acetaat; CJC1295 met uit DAC
    CAS: 863288-34-0
    MF: C159H258N46O45
    Mw: 0
    Productcategorieën: Peptides

    Ons proces:
    Het kwaliteitscontroleprocédé
    1) Het kopen
    Het grondige marktonderzoek, begrijpt de prijs van grondstoffen en prestaties. Aan de verwervingsbron volledig, volledig de kwaliteit van de verwerving van grondstoffen te begrijpen en te waarborgen.

    2) Inspectie
    Vier stappen: bemonstering, steekproefvoorbehandeling, het meten en gegevens - verwerking.

    3) Het produceren
    a) Elke exploitant moet zelfinspectie van producs doen en de overeenkomstige inspectieverslagen maken.
    B) Volledige inspecteurs door controle de exploitantzelfinspectie, en overzicht en teken in het overeenkomstige verslag. De volledige inspectie is de oorzaak van inspectie van afgewerkt product, en maakt tot het afgewerkte product inkomende inspectieverslagen.

    4) Alvorens te verkopen
    Het testresultaat kan worden opgeleverd alvorens te verkopen.
    De instelling van de derdeopsporing wordt toegestaan als u niet tevreden met testresultaten bent.

    Onze voordelen:
    1. Kwaliteit:
    Ons bedrijf is een professionele productie van hormoontussenpersonen vele jaren, hebben onze producten uitgevoerd naar Duitsland, Spanje, het UK, de V.S., Australië, Midden-Oosten, etc. ander land, en wij hebben zeer goed terugkoppelen van onze klanten, kunt u op ons vertrouwen.
    En wij zijn manufactory, zo geen probleem voor ons om de kwaliteit te controleren.
    2. Betalingswijze: Western Union, TT.
    3. De dienst: De beste dienst met de naverkoopdienst aan alle cliënten.
    4. Levering:
    Steekproeforde: Het pakket zal met 3days na betaling worden verscheept. Wij kunnen het via OMHOOGGAAND, EMS, de Luchtpost van HK, DHL verzenden of othermethod. Wij hebben een professionele en stabiele logistiek, en wij kunnen het pakket leveren regelmatig rond 3 tot 5 dagen.

    Andere Peptide Onze Laboratoriumlevering:

    Product Zuiverheid CAS Nr.
    Glucagonwaterstofchloride 98% 16941-32-5
    Gonadorelinacetaat 98% 34973-08-5
    Goserelinacetaat 98% 145781-92-6
    Van GRF (de menselijke) Acetaat 98% 83930-13-6
    Hexarelinacetaat 98% 140703-51-1
    Histrelinacetaat 98% 76712-82-8
    Icatibantacetaat 98% 30308-48-4
    Lanreotide 98% 108736-35-2
    Lecirelin (Dalmarelin) Acetaat 98% 61012-19-9
    Leuprolide 98% 74381-53-6
    Leuprorelinacetaat 98% 53714-56-0
    Linaclotide Acatate 98% 851199-59-2
    Lixisenatide 98% 320367-13-3
    Lraglutide 98% 204656-20-2
    Lysipressinacetaat 98% 50-57-7
    Melanotan II Acetaat 98% 121062-08-6
    MOG (35-55) 98% 163913-87-9
    Nafarelinacetaat 98% 76932-56-4
    Nesiritideacetaat (bnp-32) 98% 114471-18-0
    Octreotide 98% 79517-01-4
    Ornipressinacetaat 98% 3397-23-7
    Oxytocin Acetaat 98% 50-56-6
    Palmitoyl Pentapeptide 98% 214047-00-4
    Pexiganan 98% 147664-63-9
    Pramlintideacetaat 98% 196078-30-5
    PT141 acetaat 98% 32780-32-8
    Zalmcalcitonin Acetaat 98% 47931-85-1
    Secretinacetaat 98% 10813-74-8
    Sermorelinacetaat 98% 86168-78-7
    Sincalide 98% 25126-32-3
    Somatostatin Acetaat 98% 38916-34-6
    Splenopentinacetaat 98% 105184-37-0
    Taltirelinacetaat 98% 103300-74-9
    Teriparatideacetaat 98% 52232-67-4
    Teriparatideacetaat 98% 52232-67-4
    Terlipressinacetaat 98% 14636-12-5
    Tetracosactideacetaat 98% 16960-16-0
    Thymalfasin 98% 62304-98-7
    Thymopentin 98% 69558-55-0
    Thymosinα1 Acetaat 98% 14636-12-5
    Thymosinβ4 Acetaat (tb-500) 98% 77591-33-4
    Triptorelinacetaat 98% 57773-63-4
    Vapreotideacetaat 98% 103222-11-3
    Vasopressinacetaat 98% 9034-50-8
    Ziconotideacetaat 98% 107452-89-1



    Spier de Bouwpeptides cjc-1295 zonder DAC voor Bodybuilders

    VIP Cliëntenbeleid:
    Als uw het Kopen Totaal Bedrag in ons bedrijf per jaar 50.000 USD, begin jaar kon bereiken, konden wij 2%-5% van het Totale Bedrag gebruiken om Vrije goederen te verzenden.

    Klantentypes die meer steun hadden:
    1.Potential klant
    (Met het Kopen van de Cliëntenaantal van de Gegevens+clients' Huidige Markt en Productenhoeveelheid per maand om van toepassing te zijn)

    2.Stable klantengroep en stabiele Hoeveelheidsorde per maand
    (Met volledige Kopende Gegevens met ons Toe te passen bedrijf)

    3.Regular persoonlijke Gebruikers
    (Met volledige Kopende Gegevens met ons Toe te passen bedrijf)

    4.Clients die fondsen hebben en plan hebben om markt uit te breiden
    (Met het Kopen van de Cliëntenaantal van de Gegevens+clients' Huidige Markt en Productenhoeveelheid per maand om van toepassing te zijn)
    ** Huidige Echte Data+Future-Markt (die op Stroom wordt gebaseerd)

    Passion Technology Development Limited

    Contactpersoon: Qin

    Direct Stuur uw aanvraag naar ons (0 / 3000)

    Andere Producten
    Vraag een offerte aan

    E-Mail | Sitemap

    Privacy Policy China Goed Kwaliteit Injecteerbare Peptides Leverancier. © 2018 - 2020 All Rights Reserved.